Tesamorelin research reference: CAS, molecular weight, sequence and HPLC/MS identity

Tesamorelin (also coded TH9507) is a synthetic analog of human growth-hormone-releasing hormone residues 1–44. Compared with native GHRH(1-44), the N-terminus carries a trans-3-hexenoyl ( (3E)-hex-3-enoyl ) acyl group instead of a free amine. That modification is why PubChem synonym lists include N-((3E)-1-oxo-3-hexenyl)somatoliberin and (3E)-hex-3-enoylsomatoliberin.

FDA GSRS publishes the 44-amino-acid backbone under UNII MQG94M5EEO as YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL. PubChem CID 16137828 publishes the full modified molecule as C221H366N72O67S at 5136 g/mol. When a vendor page quotes a different mass, check whether it omitted the hexenoyl group, counted a different salt, or rounded a monoisotopic mass.

For purchase orders and receiving logs, record CAS 218949-48-5, formula C221H366N72O67S and average MW 5136 g/mol, and cite PubChem CID 16137828 or FDA GSRS UNII MQG94M5EEO. If a certificate prints only “tesamorelin” without CAS or mass, ask the issuer to add them before you accept the lot into a regulated inventory system.

PubChem lists more than one CAS-like synonym on the same CID. Prefer 218949-48-5, which is the primary CAS associated with the PubChem property table we retrieved on 2026-11-06.

1. Write the CAS and PubChem CID on the receiving worksheet next to the vial lot number.
2. Do not mix label claim (mg on the vial) with measured quantity (mg on the lot report) without noting which one you used.
3. If LC-MS is claimed, keep a screenshot or PDF of the ion series with the lot file.

A useful research-peptide certificate for this compound states the lot number that matches the vial, the laboratory name, the chromatographic method, an area-percent (or equivalent) purity with integration rules, and a measured quantity for the tested sample. When identity is claimed, mass spectrometric evidence should land near the charge-state series calculated from ~5136 Da (for example [M+4H]4+ near m/z 1284 and [M+5H]5+ near m/z 1028), allowing for salt, adducts and calibration.

Large GHRH-length peptides can show oxidation, deamidation and truncated sequences as satellite peaks. A chromatogram that shows only a single unlabeled peak without MS support is weaker evidence than a report that pairs HPLC purity with an MS ion series.

1. Lot number on the vial matches the report.
2. HPLC purity with method wavelength / column class stated.
3. Measured mg for the tested sample of that lot.
4. If identity is claimed: MS ions consistent with the ~5136 Da average mass.
5. Issuer name and a path to look the report up (lab portal or our lot page).

We list tesamorelin research vials for laboratory use. No lab report for tesamorelin is published on this site right now; a lab report is available on request for the specific lot you would receive. Treat any report as a lot-specific document for the tested sample named on it, not as proof that every future lot carries the same purity or quantity.

US and self-serve Canada/Mexico checkout use US fulfillment. Credentialed institutional export for eligible overseas laboratories goes through /international-lab-orders. We do not offer self-serve shipping to Australia, New Zealand, or OFAC-sanctioned destinations.