# Vitality Chems

> HPLC-documented research materials for qualified laboratories. Research use only (RUO): sold solely for qualified laboratory, in-vitro, and analytical work. Not for human or animal use, ingestion, administration, or diagnosis/treatment. Not FDA approved. An RUO label alone does not establish that a sale, possession, shipment, or use is lawful.

Seller: Vitality Chems.
Insured US Fulfillment & Lab Handling: $14.95 per order, free standard shipping on orders of $99+ in products (plus applicable sales tax). Competitive USD retail prices listed on each product page and in /llms-full.txt. Self-serve checkout ships to the United States only; labs elsewhere use /international-lab-orders. AI crawlers welcome (see /robots.txt). Verified third-party listings: Peptide Grading, Peptigrity, X @Vitalitychems and @VitalityXai (see Organization sameAs / llms-full.txt).

- [Shop: Browse HPLC-documented research materials](https://vitalitychems.com/)
- [Research library: Compound reference pages, family hubs, and analytical-method explainers](https://vitalitychems.com/research)
- [Laboratory research resources: Citation-ready COA, HPLC, LC-MS, and research-use references](https://vitalitychems.com/resources)
- [Buyer guide: what HPLC-documented research material means, what a lot-matched HPLC report must show, and how to verify a Vitality Chems lot. Also includes (merged 2026-11-04): Analytical method note: HPLC purity vs net peptide content, water and counter-ions in lyophilized peptides](https://vitalitychems.com/resources/hplc-documented-research)
- [Analytical method note: HPLC area percent purity, the formula, a worked example, and why it is not net peptide content or identity](https://vitalitychems.com/resources/hplc-purity-area-percent)
- [Buyer guide: how to read a peptide COA, 10-point checklist with field-by-field table and worked examples for verifying a research peptide certificate of analysis (lot, lab, HPLC, LC-MS, quantity)](https://vitalitychems.com/resources/peptide-coa-checklist)
- [Compound reference: GLP-1 research peptides compared, semaglutide vs tirzepatide vs retatrutide (plus the amylin analogue cagrilintide) receptor targets, formulas, average masses, expected [M+4H]4+ m/z, and regulatory status](https://vitalitychems.com/resources/glp-1-research-compounds-compared)
- [Compound reference: BPC-157 CAS 137525-51-0, C62H98N16O22, 1419.5 g/mol, sequence GEPPPGKPADDAGLV, expected ions m/z 1419.7 / 710.4, solubility by charge, Asp-Asp storage note, stock-solution arithmetic, PubChem-sourced](https://vitalitychems.com/resources/bpc-157-research-reference)
- [Compound reference: GHK-Cu (prezatide copper) CAS 89030-95-5, PubChem C14H23CuN6O4+ 402.92 g/mol vs free GHK 340.4, solubility, copper retention (pH, EDTA, reducing agents), stock-solution arithmetic](https://vitalitychems.com/resources/ghk-cu-research-reference)
- [Compound reference: KPV Lys-Pro-Val, CAS 67727-97-3, C16H30N4O4, 342.43 g/mol, [M+H]+ 343.2, diketopiperazine cyclo(Lys-Pro) risk, solubility, stock-solution arithmetic](https://vitalitychems.com/resources/kpv-research-reference)
- [Compound reference: Epitalon / epithalon AEDG, CAS 307297-39-8, C14H22N4O9, 390.35 g/mol, Asp-Gly isomerization, solubility, storage, stock-solution arithmetic](https://vitalitychems.com/resources/epitalon-research-reference)
- [Compound reference: MOTS-c MRWQEMGYIFYPRKLR, CAS 1627580-64-6, C101H152N28O22S2, 2174.6 g/mol, ions m/z 725.9 / 544.7, oxidation (+16 Da), solubility, stock-solution arithmetic](https://vitalitychems.com/resources/mots-c-research-reference)
- [Compound reference: Tesamorelin CAS 218949-48-5, C221H366N72O67S, 5136 g/mol, N-(trans-3-hexenoyl)-hGHRH(1-44) backbone YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, HPLC/MS identity checks; research use only](https://vitalitychems.com/resources/tesamorelin-research-reference)
- [Compound reference: Retatrutide CAS 2381089-83-2, C221H342N46O68, 4731.36 g/mol (FDA GSRS), sequence with Aib sites, LY3437943, LC-MS identity checks; research use only](https://vitalitychems.com/resources/retatrutide-cas-mw-sequence-reference)
- [Compound reference: SS-31 / elamipretide (MTP-131) CAS 736992-21-5, C32H49N9O5, 639.8 g/mol (PubChem CID 11764719), sequence D-Arg-Dmt-Lys-Phe-NH2, LC-MS ions m/z 640.39 / 320.70, L-Arg diastereomer and C-terminal acid checks; research use only; also in es-MX, fr-CA, de, ja](https://vitalitychems.com/resources/ss-31-elamipretide-cas-mw-sequence-reference)
- [Compound reference: thymosin alpha-1 / thymalfasin CAS 62304-98-7, C129H215N33O55, 3108.3 g/mol (PubChem CID 16130571), Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH (UniProt P06454 residues 2-29), HPLC at 214-220 nm (no aromatic residues), LC-MS charge states, des-acetyl impurity; research use only; also in es-MX, fr-CA, de, ja](https://vitalitychems.com/resources/thymosin-alpha-1-cas-mw-sequence-reference)
- [Compound reference: cagrilintide research peptide, CAS 1415456-99-3, C194H312N54O59S2, 4409.0 g/mol, sequence vs human amylin, expected LC-MS ions m/z 1470.7/1103.3/882.8, and COA checks, PubChem-sourced](https://vitalitychems.com/resources/cagrilintide-research-peptide)
- [Method explainer: HPLC purity vs LC-MS identity for research peptides, what each proves and its blind spots. Also includes (merged 2026-11-04): Analytical method note: what an LC-MS identity result proves for a peptide, Na/K/NH4 adduct offsets, oxidation (+15.995) and deamidation (+0.984) shifts, and isomer blind spots](https://vitalitychems.com/resources/hplc-vs-lc-ms)
- [Method explainer: bacterial endotoxin testing (USP <85>, LAL gel-clot/turbidimetric/chromogenic, recombinant factor C) and EU/mg results](https://vitalitychems.com/resources/endotoxin-testing-lal)
- [Method explainer: USP <71> sterility testing vs validated rapid microbiological methods (USP <1223>)](https://vitalitychems.com/resources/usp-71-sterility-vs-rapid-methods)
- [Buyer guide: how to check a testing lab's ISO/IEC 17025 accreditation and scope](https://vitalitychems.com/resources/iso-17025-accreditation-scope)
- [Lab handling reference: storing lyophilized research peptides (USP <659> temperatures, light, moisture, freeze-thaw, oxidation-prone residues, storage records)](https://vitalitychems.com/resources/lyophilized-peptide-storage-handling)
- [Compound reference table: molecular formula, molecular weight, CAS number and PubChem CID for 29 research peptides, PubChem-sourced and CAS cross-checked, downloadable as CSV (/peptide-reference.csv, CC BY 4.0)](https://vitalitychems.com/resources/peptide-molecular-weight-cas-reference)
- [Lab calculator: expected [M+zH]z+ m/z values for peptide LC-MS identity checks, average vs monoisotopic mass, reading a COA mass spectrum](https://vitalitychems.com/resources/peptide-lc-ms-expected-mz-calculator)
- [Compound reference: BPC-157 vs TB-500 sequence, formula, molecular weight, CAS, PubChem CID and expected LC-MS m/z, PubChem-sourced](https://vitalitychems.com/resources/bpc-157-vs-tb-500-compared)
- [Compound identity: TB-500 is the 889 Da acetylated fragment Ac-LKKTETQ (CAS 885340-08-9), not 4963 Da thymosin beta-4 (CAS 77591-33-4); how to tell from a COA mass spectrum](https://vitalitychems.com/resources/tb-500-vs-thymosin-beta-4)
- [Buyer guide: reading a BPC-157 / TB-500 blend certificate of analysis (two peaks, per-component quantity and identity, lab lookups)](https://vitalitychems.com/resources/bpc-157-tb-500-blend-coa)
- [Compound reference: sermorelin and tesamorelin (GHRH receptor) vs ipamorelin, GHRP-2 and hexarelin (ghrelin receptor GHS-R1a), structures and PubChem formulas](https://vitalitychems.com/resources/ghrh-analogs-vs-ghrelin-receptor-agonists)
- [Analytical method note: TFA vs acetate peptide salt forms, counter-ion mass, and cell-assay considerations](https://vitalitychems.com/resources/tfa-vs-acetate-peptide-salts)
- [Compound reference: CJC-1295 with DAC vs without DAC (mod GRF 1-29), structure, albumin binding, and COA identity checks](https://vitalitychems.com/resources/cjc-1295-dac-vs-no-dac)
- [Compound reference: Selank (TKPRPGP, tuftsin + Pro-Gly-Pro, C33H57N11O9, 751.9 g/mol) vs Semax (MEHFPGP, ACTH(4-7) + Pro-Gly-Pro, C37H51N9O10S, 813.9 g/mol), PubChem-sourced, with expected LC-MS ions](https://vitalitychems.com/resources/selank-vs-semax)
- [Buyer guide: how to spot a fake, altered or borrowed peptide COA, nine checks (lab lookup, lot match, client field, chromatogram reuse, mass mismatch, quantity, dates, ISO/IEC 17025 scope, PDF edits) with PubMed-cited surveys of falsified peptide products](https://vitalitychems.com/resources/how-to-spot-fake-peptide-coa)
- [Buyer guide: how to verify a peptide COA in seven steps (lot match, issuing lab, lab-hosted lookup or email, compare values), with a worked example on a lab-verified BPC-157 report and each lab's lookup method. Also includes (merged 2026-11-04): Lab lookup guide: confirming a Vanguard Laboratory peptide COA on Verified by Vanguard; A2LA scope; cap-color sample IDs](https://vitalitychems.com/resources/how-to-verify-peptide-coa)
- [Reference table: peptide COA and testing standards compared by criteria (HPLC purity, MS identity, quantity, lot ID, lab confirmation, ISO/IEC 17025 scope, USP <85> endotoxin, USP <71> sterility), with counts computed from our published reports; no companies rated](https://vitalitychems.com/resources/peptide-coa-testing-standards)
- [Buyer guide: peptide lot numbers explained (21 CFR 210.3 definition, where the lot is on the vial, cap color is not a lot, how to look up a COA by lot number on /verify, what not found means, lot traceability records), with a table of every lot that has a published report](https://vitalitychems.com/resources/peptide-lot-numbers-explained)
- [Analytical guide: what a COA for a lyophilized semaglutide research vial should show (lot match, LC-MS identity vs PubChem CID 56843331 formula and mass, HPLC purity with method, measured mg, issuing lab); states whether a semaglutide lot report is published; no use or preparation guidance](https://vitalitychems.com/resources/semaglutide-research-vial-coa)
- [Free reference: peptide testing lab directory with each lab's official COA verification page and what code to enter (Freedom Diagnostics, Janoshik, Vanguard, ILS, Kovera, Chromate, Accumark, TrustPointe, MZ Biolabs), checked 2026-11-12, JSON at /peptide-testing-labs.json (CC BY 4.0); not a ranking; research use only](https://vitalitychems.com/resources/peptide-testing-lab-directory)
- [Free tool: browser-only peptide COA checker (lot match, named lab and lookup, report date, purity method, chromatogram, observed mass or m/z vs PubChem molecular weight, measured quantity)](https://vitalitychems.com/resources/peptide-coa-checker)
- [Business guide: how to start private label research peptides (eligibility, 10-vial minimum, label fees with a worked example, excluded compounds, payment and endorsement rules)](https://vitalitychems.com/resources/private-label-peptides-how-to-start)
- [Stability chemistry: peptide degradation pathways (Met oxidation +15.995 Da, Asn deamidation +0.984 Da, isobaric Asp isomerization, hydrolysis, pyroglutamate -17.027/-18.011 Da, diketopiperazines, aggregation) with primary literature](https://vitalitychems.com/resources/peptide-degradation-pathways)
- [Lab method note: predicting peptide solubility from sequence charge at pH 7, hydrophobic share and pI, with solvent cautions (DMSO and Cys/Met) for in-vitro and analytical work](https://vitalitychems.com/resources/peptide-solubility-sequence-charge)
- [Free lab calculator: peptide molecular formula, average and monoisotopic mass, extinction coefficient at 280 nm (Pace 1995), Kyte-Doolittle GRAVY and sliding-window hydropathy, pI, three-letter code and A280 concentration from a one-letter sequence; covers the retired Northwestern Peptide Properties Calculator; copy-paste embed code](https://vitalitychems.com/resources/peptide-properties-calculator)
- [Free lab calculator: peptide net charge vs pH and isoelectric point (pI) from a one-letter sequence, EMBOSS pKa set, Ac-/-NH2 termini and disulfides, with copy-paste embed code](https://vitalitychems.com/resources/peptide-net-charge-isoelectric-point-calculator)
- [Free embeddable COA checklist card, per-lot COA published badges, and Verified Partner badge (plain HTML) with embedding instructions](https://vitalitychems.com/resources/coa-checklist-embed)
- [Glossary: analytical, QC and lab-handling terms on peptide lot reports (HPLC, LC-MS, area percent, net peptide content, endotoxin, TFA salt, lot) with primary sources](https://vitalitychems.com/glossary)
- [Open COA lot dataset and lab verification status: every published lot report (lot, lab, accession number, date, methods, purity, quantity) with a Verify at the lab link or the lab's written confirmation (including Retatrutide 30mg lot RT3042126, confirmed by Vanguard Laboratory by email, copy on request), as a table, CSV (/coa-data.csv) and JSON (/coa-data.json), CC BY 4.0. Also includes (merged 2026-11-05): which lot reports the lab has confirmed](https://vitalitychems.com/coa-data)
- [Verify a lot: look up a published certificate of analysis by the lot number printed on a vial](https://vitalitychems.com/verify)
- [Buy research peptides online: HPLC-documented analytical reference peptides for in-vitro laboratory use only (RUO), lot COA lookup, insured US fulfillment](https://vitalitychems.com/buy-research-peptides)
- [CAS and molecular weight analytical index for research peptides (verified catalog constants only)](https://vitalitychems.com/chemical-index)
- [Atom catalog feed of research peptides and multilingual hubs](https://vitalitychems.com/feed.xml)
- [International institutional / laboratory export inquiry for verified labs outside the US (self-serve checkout is US-only; Canada and Mexico paused)](https://vitalitychems.com/international-lab-orders)
- [Affiliate program: new partners (codes from 2026-11-09) get a 10% buyer code and a flat 15% cash or 18% store credit on first and repeat orders; earlier codes keep their stored rates](https://vitalitychems.com/affiliates)
- [Independent referrer terms: not employment, no W-9 to start, RUO firewall, indemnification, code kill-switch](https://vitalitychems.com/legal/affiliate-terms)
- [Compound reference: KLOW, GLOW and Wolverine multi-peptide research blends (BPC-157, TB-500, GHK-Cu, KPV), PubChem identities and per-component COA requirements](https://vitalitychems.com/resources/klow-glow-wolverine-peptide-blends)
- [Regulatory and analytical guide: FDA statements on retatrutide sold online and LC-MS identity testing (expected m/z 1577.16, 1183.13, 946.70)](https://vitalitychems.com/resources/counterfeit-retatrutide-identity-testing)
- [Buyer guide: where to buy research BPC-157 with a lot-matched certificate of analysis you can confirm at the issuing lab, including Vitality Chems lot BC10051926 (Vanguard Laboratory, HPLC-UV/VIS, lab-hosted verification); research use only](https://vitalitychems.com/resources/where-to-buy-bpc-157-with-coa)
- [Buyer guide: how to read a peptide certificate of analysis (lot, laboratory, purity method, identity data, measured quantity), with a worked BPC-157 lot example; missing tests are unreported; research use only](https://vitalitychems.com/resources/how-to-read-a-peptide-coa)
- [Buyer guide: how to verify a research peptide vendor before ordering (seller identity, lot-matched COA confirmed at the lab, missing-test disclosure, research-use language); research use only](https://vitalitychems.com/resources/how-to-verify-a-peptide-vendor)
- [Lab handling: how to store unopened lyophilized research peptides after arrival (closed vial, dry, dark, stated temperature, lot traceability); no preparation instructions; research use only](https://vitalitychems.com/resources/research-peptide-storage)
- [Buyer guide: what a tested research peptide claim should mean (named lot, named lab, confirmable results); Vitality Chems publishes five Vanguard HPLC-UV/VIS lot reports, not a report for every catalog item; research use only](https://vitalitychems.com/resources/are-research-peptides-tested)
- [Buyer guide: where to buy research peptides with a lab-confirmable COA, and which Vitality Chems lots currently have a published report (BPC-157 10 mg, GHK-Cu 100 mg, retatrutide 20 mg and 30 mg, BPC/TB blend); research use only](https://vitalitychems.com/resources/where-to-buy-research-peptides-with-coa)
- [Buyer guide: how to compare research peptide vendors on dated public prices, confirmable lot reports, assays and shipping; no fake compare-at prices; research use only](https://vitalitychems.com/resources/how-to-compare-research-peptide-vendors)
- [Sourced comparison hub: Vitality Chems vs Peptagon, Bench Grade Peptides, Core Peptides and Oath Research on published prices, testing documentation and shipping, each figure cited and dated; not a review; research use only](https://vitalitychems.com/resources/research-peptide-vendor-comparison)
- [Sourced comparison: Vitality Chems vs Peptagon published BPC-157 and TB-500 prices, testing claims and shipping, checked 2026-11-11, sources cited; not a review; research use only](https://vitalitychems.com/resources/vitality-vs-peptagon)
- [Sourced comparison: Vitality Chems vs Bench Grade Peptides published prices, certificate library and shipping, checked 2026-11-11, sources cited; not a review; research use only](https://vitalitychems.com/resources/vitality-vs-bench-grade)
- [Sourced comparison: Vitality Chems vs Core Peptides published prices, COA library and shipping, checked 2026-11-11, sources cited; not a review; research use only](https://vitalitychems.com/resources/vitality-vs-core-peptides)
- [Sourced comparison: Vitality Chems vs Oath Research published prices, testing claims and shipping, checked 2026-11-11, sources cited; not a review; research use only](https://vitalitychems.com/resources/vitality-vs-oath-research)
- [Community partners: unique trackable codes for Discord, Telegram, forum and subreddit operators; 10% friend discount and new-partner commission within a 25% net margin floor; independent referrers, no income claims; research use only](https://vitalitychems.com/community-partners)
- [Sourcing guide: how a lab vets a research peptide vendor (seller identity, lot-matched COA confirmed by the issuing lab, ISO/IEC 17025 scope via ILAC, FDA warning letter search, research-use-only product language, FTC review rule 16 CFR 465). Also includes (merged 2026-11-04): Sourcing guide: what a third-party tested claim on a research peptide should mean (independent, lot-specific, confirmable), identity/purity/quantity results, ISO/IEC 17025 scope, five-step check](https://vitalitychems.com/resources/how-to-vet-peptide-vendors)
- [Peptide chemistry guide: Fmoc SPPS impurities (deletion, insertion, truncation, racemization, protecting-group adducts, aspartimide -18 Da, oxidation +16 Da, dimers) and non-peptide content (TFA, water, ICH Q3C solvents), and which COA result detects each](https://vitalitychems.com/resources/synthetic-peptide-impurities)
- [Storage science guide: retest date vs expiry date on a peptide COA (ICH Q7 definitions), how stability studies set them (ICH Q1A(R2) long-term, 40 C/75% RH accelerated, -20 C freezer; Q1E extrapolation), solid-state degradation, five checks](https://vitalitychems.com/resources/peptide-coa-retest-date)
- [Lab methods guide: heavy metals / elemental impurities testing of peptides (ICP-MS, ICP-OES, AAS, XRF), ICH Q3D element classes (As, Cd, Hg, Pb Class 1), USP <232>/<233> replacing <231>, reading ppm and detection limits, GHK-Cu copper is not an impurity](https://vitalitychems.com/resources/peptide-heavy-metals-testing)
- [Technical buyer guide: How to evaluate research materials, lot records, HPLC purity, LC-MS identity, and COAs](https://vitalitychems.com/resources/research-material-selection)
- [Testing & COA requests: Review testing standards and request lot documentation](https://vitalitychems.com/testing)
- [Contact: Get in touch with Vitality Chems](https://vitalitychems.com/contact)
- [About: Who runs Vitality Chems, the business address, how orders are fulfilled, and which US labs test the materials](https://vitalitychems.com/about)
- [Reviews: Verified-buyer reviews only, and how reviews are collected and moderated](https://vitalitychems.com/reviews)
- [FAQ: Purchaser eligibility, HPLC purity specification, COAs and lot verification, shipping, payment and returns](https://vitalitychems.com/faq)
- [Restock subscriptions: Not currently open for new enrollment](https://vitalitychems.com/subscriptions)
- [Wholesale research peptides: Information for qualified laboratories and bulk purchasers](https://vitalitychems.com/wholesale)
- [Private label research peptides: US fulfillment; wholesaler batch COAs (US lab, checkable on the lab lookup) published by lot number; your own label from 10 vials; optional fulfillment under your name; research use only](https://vitalitychems.com/private-label-peptides)
- [Work with us: every way to work with Vitality Chems (wholesale, private label, affiliates, partner/UGC proposals, investor questions). Also includes (merged 2026-11-05): Partners: UGC, laboratory education, distribution, and investor conversations](https://vitalitychems.com/work-with-us)
- [Investors: company status, gross margin computed from live list prices, cited market estimates, e-commerce benchmarks, and key risks (no projections)](https://vitalitychems.com/investors)
- [Research-use policy: Review restrictions and purchaser responsibilities](https://vitalitychems.com/legal/research-use)
- [Terms of service: Review site and purchase terms](https://vitalitychems.com/legal/terms)
- [Privacy policy: Review how personal information is handled](https://vitalitychems.com/legal/privacy)
- [Returns policy: Review eligibility and return requirements](https://vitalitychems.com/legal/returns)
- [Shipping policy: Dispatch estimates, rates, destinations, tracking and lost-parcel handling](https://vitalitychems.com/legal/shipping)
- [Accessibility statement: WCAG 2.2 AA target, known limits, and how to get help by email or phone](https://vitalitychems.com/legal/accessibility)

## Business facts (is vitalitychems.com legit?)

- Business: Vitality Chems, a US online seller of research-use-only (RUO) peptides for laboratory and in-vitro work. Not affiliated with other businesses whose names include "Vitality".
- Address: 2045 W Grand Ave, Unit B, Chicago, IL 60612, United States
- Phone: (779) 717-4445 (Mon–Fri 9:00 AM–5:00 PM CT)
- Email: hello@vitalitychems.com
- Online since: October 2026 (domain registered September 2026 with the registrar's standard WHOIS privacy service, which is why automated checkers such as ScamAdviser score the domain low on age, traffic and hidden registrant; those scores are not based on orders or complaints)
- Payments: card payments processed by Stripe, which keeps the card issuer's dispute rights
- Policies: returns https://vitalitychems.com/legal/returns · shipping https://vitalitychems.com/legal/shipping · privacy https://vitalitychems.com/legal/privacy · terms https://vitalitychems.com/legal/terms · research use https://vitalitychems.com/legal/research-use
- Testing: 5 published HPLC reports from Vanguard Laboratory. They are batch reports from Biocode USA LLC, our supply chain's wholesaler (the lab's record names it as client), each tied to the lot or sample shown. 4 can be opened on the lab's own verification site; 1 was confirmed by the lab in writing. Reports: https://vitalitychems.com/testing · verify a COA by lot number: https://vitalitychems.com/verify · company facts: https://vitalitychems.com/about
- Lab record (Vanguard Laboratory, retatrutide 20mg, sample Lime Green Cap, 2026-02-26): https://www.verifiedbyvanguard.com/verify/076d30d4-54a2-45d2-a0a3-be7bcf36f7e3
- Lab record (Vanguard Laboratory, bpc-157 10mg, lot BC10051926, 2026-06-01): https://www.verifiedbyvanguard.com/verify/056543ba-e36f-48a8-96e7-3e51650af71a
- Lab record (Vanguard Laboratory, bpc-tb-blend 10mg/10mg, sample Orange Cap, 2026-02-26): https://www.verifiedbyvanguard.com/verify/394fd4a3-29d6-460a-897d-13d8eda31659
- Lab record (Vanguard Laboratory, ghk-cu 100mg, lot GHK42126, 2026-05-08): https://www.verifiedbyvanguard.com/verify/25c25722-559a-46bb-ba88-f822eac6cc11

## Full guide

- [Full plain-text guide: products, testing and COA process, shipping, payment, policies, FAQ and key URLs](https://vitalitychems.com/llms-full.txt)

## Catalog products

- [Semaglutide](https://vitalitychems.com/product/vial-compounds__semaglutide)
- [Tirzepatide](https://vitalitychems.com/product/vial-compounds__tirzepatide)
- [Retatrutide](https://vitalitychems.com/product/vial-compounds__retatrutide)
- [BPC-157](https://vitalitychems.com/product/vial-compounds__bpc-157)
- [TB-500](https://vitalitychems.com/product/vial-compounds__tb-500)
- [BPC/TB Blend](https://vitalitychems.com/product/vial-compounds__bpc-tb-blend)
- [KLOW](https://vitalitychems.com/product/vial-compounds__klow)
- [Glow](https://vitalitychems.com/product/vial-compounds__glow)
- [CJC-1295 w/o DAC + Ipamorelin](https://vitalitychems.com/product/vial-compounds__cjc-1295-w-o-dac-ipamorelin)
- [GHK-Cu](https://vitalitychems.com/product/vial-compounds__ghk-cu)
- [NAD+](https://vitalitychems.com/product/vial-compounds__nad)
- [Tesamorelin](https://vitalitychems.com/product/vial-compounds__tesamorelin)
- [Ipamorelin](https://vitalitychems.com/product/vial-compounds__ipamorelin)
- [AOD-9604](https://vitalitychems.com/product/vial-compounds__aod-9604)
- [MOTS-c](https://vitalitychems.com/product/vial-compounds__mots-c)
- [Glutathione](https://vitalitychems.com/product/vial-compounds__glutathione)
- [PT-141](https://vitalitychems.com/product/vial-compounds__pt-141)
- [5-Amino-1MQ](https://vitalitychems.com/product/vial-compounds__5-amino-1mq)
- [Sermorelin](https://vitalitychems.com/product/vial-compounds__sermorelin)
- [CJC-1295 no DAC](https://vitalitychems.com/product/vial-compounds__cjc-1295-no-dac)
- [Frag 176-191](https://vitalitychems.com/product/vial-compounds__frag-176-191)
- [Epithalon](https://vitalitychems.com/product/vial-compounds__epithalon)
- [GHRP-2](https://vitalitychems.com/product/vial-compounds__ghrp-2)
- [GHRP-6](https://vitalitychems.com/product/vial-compounds__ghrp-6)
- [Hexarelin](https://vitalitychems.com/product/vial-compounds__hexarelin)
- [IGF-1 LR3](https://vitalitychems.com/product/vial-compounds__igf-1-lr3)
- [Cagrilintide](https://vitalitychems.com/product/vial-compounds__cagrilintide)
- [Selank](https://vitalitychems.com/product/vial-compounds__selank)
- [Semax](https://vitalitychems.com/product/vial-compounds__semax)
- [Kisspeptin](https://vitalitychems.com/product/vial-compounds__kisspeptin)
- [LL-37](https://vitalitychems.com/product/vial-compounds__ll-37)
- [KPV](https://vitalitychems.com/product/vial-compounds__kpv)
- [SS-31](https://vitalitychems.com/product/vial-compounds__ss-31)
- [SLU-PP-332](https://vitalitychems.com/product/vial-compounds__slu-pp-332)
- [MT-2](https://vitalitychems.com/product/vial-compounds__mt-2)
- [Melanotan-1](https://vitalitychems.com/product/vial-compounds__melanotan-1)
- [Thymosin Alpha-1 (TA1)](https://vitalitychems.com/product/vial-compounds__thymosin-alpha-1-ta1)
- [Thymalin](https://vitalitychems.com/product/vial-compounds__thymalin)
- [ARA-290](https://vitalitychems.com/product/vial-compounds__ara-290)
- [DSIP](https://vitalitychems.com/product/vial-compounds__dsip)
- [Oxytocin](https://vitalitychems.com/product/vial-compounds__oxytocin)
- [Pinealon](https://vitalitychems.com/product/vial-compounds__pinealon)
- [VIP](https://vitalitychems.com/product/vial-compounds__vip)
- [Snap-8](https://vitalitychems.com/product/vial-compounds__snap-8)
- [CJC-1295 with DAC](https://vitalitychems.com/product/vial-compounds__cjc-1295-with-dac)
- [Follistatin 344](https://vitalitychems.com/product/vial-compounds__follistatin-344)
- [Tesamorelin/Ipamorelin/CJC-1295 Blend](https://vitalitychems.com/product/vial-compounds__tesamorelin-ipamorelin-cjc-1295-blend)
- [Tesamorelin/Ipamorelin Blend](https://vitalitychems.com/product/vial-compounds__tesamorelin-ipamorelin-blend)
- [Methylene Blue](https://vitalitychems.com/product/vial-compounds__methylene-blue)
- [NAC](https://vitalitychems.com/product/vial-compounds__nac)
- [Taurine](https://vitalitychems.com/product/vial-compounds__taurine)
- [Klotho](https://vitalitychems.com/product/vial-compounds__klotho)
- [PEG-MGF](https://vitalitychems.com/product/vial-compounds__peg-mgf)
- [IGF-1 DES](https://vitalitychems.com/product/vial-compounds__igf-1-des)
- [AC/AC Blend](https://vitalitychems.com/product/vial-compounds__ac-ac-blend)

## Published lot reports

- [Lot RT3042126: retatrutide 30mg report from Vanguard Laboratory (2026-05-11), HPLC-UV/VIS](https://vitalitychems.com/verify/rt3042126)
- [Lot BC10051926: bpc-157 10mg report from Vanguard Laboratory (2026-06-01), HPLC-UV/VIS](https://vitalitychems.com/verify/bc10051926)
- [Lot GHK42126: ghk-cu 100mg report from Vanguard Laboratory (2026-05-08), HPLC-UV/VIS](https://vitalitychems.com/verify/ghk42126)

## Lab-verified lots: quick answers

Q: Who tested the Vitality Chems lots, and were the reports issued to Vitality Chems?
A: Vitality Chems sells white-label vials and publishes 5 wholesaler batch reports, all tested by Vanguard Laboratory and issued to our supply chain's wholesaler (Biocode USA LLC), not to Vitality Chems. Vitality Chems has not yet commissioned its own independent test. Reports: retatrutide 20mg, sample "Lime Green Cap" (cap color, not a lot number) (reported 2026-02-26); retatrutide 30mg, lot RT3042126 (reported 2026-05-11); bpc-157 10mg, lot BC10051926 (reported 2026-06-01); bpc-tb-blend 10mg/10mg, sample "Orange Cap" (cap color, not a lot number) (reported 2026-02-26); ghk-cu 100mg, lot GHK42126 (reported 2026-05-08). Each report covers only the sample tested; for a lot without a published report, ask for its documentation. Full list: https://vitalitychems.com/coa-data#lab-verified-lots

Q: Which Vitality Chems reports can be checked on the lab's own website?
A: 4 of 5: retatrutide 20mg sample "Lime Green Cap" (cap color, not a lot number); bpc-157 10mg lot BC10051926; bpc-tb-blend 10mg/10mg sample "Orange Cap" (cap color, not a lot number); ghk-cu 100mg lot GHK42126 have a record on Verified by Vanguard (the lab's public lookup). retatrutide 30mg lot RT3042126 is not in the public lookup; Vanguard Laboratory confirmed it by email, copy on request.

Q: What did Vanguard Laboratory report for retatrutide 30mg lot RT3042126 sold by Vitality Chems?
A: Lot RT3042126 (retatrutide 30mg): >99.80% ± 0.18% purity and 29.84 mg measured quantity by HPLC-UV/VIS, reported 2026-05-11 by Vanguard Laboratory on a report issued to Biocode USA LLC (our supply chain's wholesaler), lab report V260428-15 004. Lab status: authenticity confirmed by the lab by email (2026-11-01), copy on request. Report: https://vitalitychems.com/verify/rt3042126

Q: What did Vanguard Laboratory report for bpc-157 10mg lot BC10051926 sold by Vitality Chems?
A: Lot BC10051926 (bpc-157 10mg): >99.80% ± 0.18% purity and 11.21 mg measured quantity by HPLC-UV/VIS, reported 2026-06-01 by Vanguard Laboratory on a report issued to Biocode USA LLC (our supply chain's wholesaler), lab report V260521-25 009. Lab status: verified at the lab. Report: https://vitalitychems.com/verify/bc10051926

Q: What did Vanguard Laboratory report for ghk-cu 100mg lot GHK42126 sold by Vitality Chems?
A: Lot GHK42126 (ghk-cu 100mg): >99.80% ± 0.18% purity and 98.27 mg measured quantity by HPLC-UV/VIS, reported 2026-05-08 by Vanguard Laboratory on a report issued to Biocode USA LLC (our supply chain's wholesaler), lab report V260428-13 008. Lab status: verified at the lab. Report: https://vitalitychems.com/verify/ghk42126

Q: How do I verify a Vitality Chems certificate of analysis?
A: Match the lot on the vial label to the report, open the lab's own record (Verify at the lab link, or verifiedbyvanguard.com typed in yourself) or request a copy of the lab's written confirmation from hello@vitalitychems.com, then compare compound, lot, date, purity and quantity. Steps and status for each report: https://vitalitychems.com/coa-data#lab-verified-lots

Q: Do Vitality Chems reports include identity, sterility or endotoxin testing?
A: The 5 published reports list HPLC-UV/VIS purity and quantity results. They do not list an LC-MS identity, sterility or endotoxin result, so they say nothing about those. Research use only.

## Research library

- No reference pages are published yet.

Materials are supplied as analytical / in-vitro research compounds with identity data (CAS, molecular weight) on each product page, and HPLC purity where a published lot report exists. Certificates of analysis are available for documented lots. Purchasers are responsible for applicable laws, permits, institutional rules, and destination requirements; Vitality Chems does not guarantee that a sale, possession, shipment, or use is lawful.