# Vitality Chems: full guide for AI answer engines

> Research use only (RUO): sold solely for qualified laboratory, in-vitro, and analytical work. Not for human or animal use, ingestion, administration, or diagnosis/treatment. Not FDA approved. An RUO label alone does not establish that a sale, possession, shipment, or use is lawful.

This is the long-form plain-text guide to https://vitalitychems.com. The short index is https://vitalitychems.com/llms.txt. Every fact below is also published on the linked page; when they differ, the linked page is current.

## About

Vitality Chems (seller: Vitality Chems) is a US seller of HPLC-documented research peptides and laboratory research materials for qualified laboratories.
- Address: 2045 W Grand Ave, Unit B, Chicago, IL 60612
- Email: hello@vitalitychems.com
- Phone: (779) 717-4445
- Hours: Mon–Fri 9:00 AM–5:00 PM CT
- Contact page: https://vitalitychems.com/contact

## Research-use policy

All products offered by Vitality Chems are intended solely for laboratory, in-vitro, analytical, and research use by qualified researchers. They are not medicines, not dietary supplements, and not medical devices. They are not intended to diagnose, treat, cure, or prevent any disease.

Vitality Chems is a seller of research chemicals and does not offer pharmacy, prescribing, dispensing, or compounding services. We are not representing these materials as approved, cleared, or authorized by the U.S. Food and Drug Administration. No product page, certificate, label, or other statement is an instruction for administration, dosing, ingestion, or clinical, veterinary, or consumer use.

Human and animal use is prohibited. Purchasers must be 21 years of age or older, must be qualified for the stated laboratory work, and must not use, resell, or transfer products for clinical, veterinary, consumer, cosmetic, or other non-research use. Purchasers are responsible for independently determining and complying with all laws, regulations, permits, institutional rules, import/export requirements, and payment-provider requirements that apply to their order and activities.

RUO labeling is descriptive of the intended research context; it does not establish regulatory legality or make any sale, possession, shipment, or use lawful. We make no guarantee that an order is legal in the purchaser's jurisdiction and may review, refuse, cancel, or hold an order when intended use, destination, purchaser information, or payment activity raises a concern. Vitality Chems is located at 2045 W Grand Ave, Unit B, Chicago, IL 60612.

Full policy: https://vitalitychems.com/legal/research-use

## Who can buy

Purchasers must be 21 or older, qualified for the stated laboratory work, and buying solely for lawful research. Checkout requires an active research-use attestation. Vitality Chems may review, hold, refuse, or cancel an order. The store does not publish human or animal dosing, administration, or usage instructions.

## Products

Catalog materials are research compounds supplied in sealed vials; the form of each is listed below. Each product page lists the available sizes, the current price for each size, the HPLC purity figure where a published lot report exists, and identity data (CAS number, molecular formula, molecular weight). Prices are not repeated here; read them on the product page.

### Semaglutide
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $90.99; 10mg $134.99; 15mg $201.99; 20mg $268.99; 30mg $327.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 910463-68-2
- Molecular weight: 4,113.6 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__semaglutide

### Tirzepatide
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $149.99; 15mg $224.99; 20mg $298.99; 30mg $446.99; 60mg $535.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 2023788-19-2
- Molecular weight: 4,813.5 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__tirzepatide

### Retatrutide
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $74.99; 20mg $135.99; 30mg $175.99
- HPLC purity (published lot report; the report for your lot governs): >99.80% ± 0.18%
- CAS number: 2381089-83-2
- Molecular formula: C₂₂₁H₃₄₂N₄₆O₆₈
- Molecular weight: 4,731.4 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__retatrutide

### BPC-157
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $82.99
- HPLC purity (published lot report; the report for your lot governs): >99.80% ± 0.18%
- CAS number: 137525-51-0
- Molecular formula: C₆₂H₉₈N₁₆O₂₂
- Molecular weight: 1,419.5 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__bpc-157

### TB-500
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $82.99; 10mg $119.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 885340-08-9
- Molecular formula: C₃₈H₆₈N₁₀O₁₄
- Molecular weight: 889.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__tb-500

### BPC/TB Blend
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg/10mg $129.99
- HPLC purity (published lot report; the report for your lot governs): >99.80% ± 0.18%
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__bpc-tb-blend

### KLOW
- Form: Lyophilized powder vial
- Sizes & USD retail: 80mg $179.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__klow

### Glow
- Form: Lyophilized powder vial
- Sizes & USD retail: 10/10/50mg $161.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__glow

### CJC-1295 w/o DAC + Ipamorelin
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg/5mg $79.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__cjc-1295-w-o-dac-ipamorelin

### GHK-Cu
- Form: Lyophilized powder vial
- Sizes & USD retail: 50mg $67.99; 100mg $87.99
- HPLC purity (published lot report; the report for your lot governs): >99.80% ± 0.18%
- CAS number: 89030-95-5
- Molecular formula: C₁₄H₂₁CuN₆O₄
- Molecular weight: 403.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ghk-cu

### NAD+
- Form: Lyophilized powder vial
- Sizes & USD retail: 500mg $90.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 53-84-9
- Molecular formula: C₂₁H₂₇N₇O₁₄P₂
- Molecular weight: 663.4 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__nad

### Tesamorelin
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $81.99; 10mg $131.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 218949-48-5
- Molecular weight: 5,135.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__tesamorelin

### Ipamorelin
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $62.99; 10mg $71.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 170851-70-4
- Molecular formula: C₃₈H₄₉N₉O₅
- Molecular weight: 711.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ipamorelin

### AOD-9604
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $83.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 221231-10-3
- Molecular formula: C₇₈H₁₂₃N₂₃O₂₃S₂
- Molecular weight: 1,815.1 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__aod-9604

### MOTS-c
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $90.99; 40mg $114.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 1627580-64-6
- Molecular formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂
- Molecular weight: 2,174.6 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__mots-c

### Glutathione
- Form: Lyophilized powder vial
- Sizes & USD retail: 1500mg $81.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 70-18-8
- Molecular formula: C₁₀H₁₇N₃O₆S
- Molecular weight: 307.3 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__glutathione

### PT-141
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $74.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 189691-06-3
- Molecular formula: C₅₀H₆₈N₁₄O₁₀
- Molecular weight: 1,025.2 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__pt-141

### 5-Amino-1MQ
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $81.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 20867-01-0
- Molecular formula: C₉H₁₀N₂O
- Molecular weight: 162.19 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__5-amino-1mq

### Sermorelin
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $74.99; 10mg $104.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 86168-78-7
- Molecular weight: 3,357.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__sermorelin

### CJC-1295 no DAC
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $70.99; 10mg $102.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 863288-34-0
- Molecular formula: C₁₅₂H₂₅₂N₄₄O₄₂
- Molecular weight: 3,367.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__cjc-1295-no-dac

### Frag 176-191
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $73.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 221231-10-3
- Molecular weight: 1,817.1 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__frag-176-191

### Epithalon
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $57.99; 50mg $106.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 307297-39-8
- Molecular formula: C₁₄H₂₂N₄O₉
- Molecular weight: 390.4 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__epithalon

### GHRP-2
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $61.99; 10mg $74.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 158861-67-7
- Molecular formula: C₄₅H₅₅N₉O₆
- Molecular weight: 817.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ghrp-2

### GHRP-6
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $61.99; 10mg $74.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 87616-84-0
- Molecular formula: C₄₆H₅₆N₁₂O₆
- Molecular weight: 873.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ghrp-6

### Hexarelin
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $81.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 140703-51-1
- Molecular formula: C₄₇H₅₈N₁₂O₆
- Molecular weight: 887.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__hexarelin

### IGF-1 LR3
- Form: Lyophilized powder vial
- Sizes & USD retail: 1mg $144.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 143045-27-6
- Molecular weight: 9,117.5 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__igf-1-lr3

### Cagrilintide
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $149.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 1415456-99-3
- Molecular formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
- Molecular weight: 4,409.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__cagrilintide

### Selank
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $62.99; 10mg $73.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 129521-63-1
- Molecular formula: C₃₃H₅₇N₁₁O₉
- Molecular weight: 751.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__selank

### Semax
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $82.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 80714-61-0
- Molecular weight: 813.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__semax

### Kisspeptin
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $73.99; 10mg $104.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 374683-24-0
- Molecular weight: 1,302.5 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__kisspeptin

### LL-37
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $81.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 154947-66-7
- Molecular weight: 4,493.3 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ll-37

### KPV
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $67.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 67727-97-3
- Molecular formula: C₁₆H₃₀N₄O₄
- Molecular weight: 342.4 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__kpv

### SS-31
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $73.99; 50mg $221.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 736992-21-5
- Molecular weight: 639.8 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ss-31

### SLU-PP-332
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $71.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 2169481-81-4
- Molecular weight: 395.8 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__slu-pp-332

### MT-2
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $63.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 121062-08-6
- Molecular formula: C₅₀H₆₉N₁₅O₉
- Molecular weight: 1,024.2 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__mt-2

### Melanotan-1
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $61.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 75921-69-6
- Molecular weight: 1,646.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__melanotan-1

### Thymosin Alpha-1 (TA1)
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $86.99; 10mg $135.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 62304-98-7
- Molecular weight: 3,108.3 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__thymosin-alpha-1-ta1

### Thymalin
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $53.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 103300-74-9
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__thymalin

### ARA-290
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $67.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 1208243-50-8
- Molecular weight: 1,761.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ara-290

### DSIP
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $60.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 62568-57-4
- Molecular formula: C₃₅H₄₈N₁₀O₁₅
- Molecular weight: 848.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__dsip

### Oxytocin
- Form: Lyophilized powder vial
- Sizes & USD retail: 2mg $39.99; 5mg $60.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 50-56-6
- Molecular formula: C₄₃H₆₆N₁₂O₁₂S₂
- Molecular weight: 1,007.2 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__oxytocin

### Pinealon
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $67.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 133167-57-2
- Molecular weight: 474.5 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__pinealon

### VIP
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $87.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 37221-79-7
- Molecular weight: 3,326.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__vip

### Snap-8
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $73.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 868844-74-0
- Molecular weight: 1,075.3 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__snap-8

### CJC-1295 with DAC
- Form: Lyophilized powder vial
- Sizes & USD retail: 5mg $106.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 446262-90-4
- Molecular formula: C₁₆₅H₂₆₉N₄₇O₄₆
- Molecular weight: 3,647.2 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__cjc-1295-with-dac

### Follistatin 344
- Form: Lyophilized powder vial
- Sizes & USD retail: 1mg $247.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__follistatin-344

### Tesamorelin/Ipamorelin/CJC-1295 Blend
- Form: Lyophilized powder vial
- Sizes & USD retail: 6mg/3mg/3mg $181.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__tesamorelin-ipamorelin-cjc-1295-blend

### Tesamorelin/Ipamorelin Blend
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg/10mg $190.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__tesamorelin-ipamorelin-blend

### Methylene Blue
- Form: Powder vial
- Sizes & USD retail: 50mg $39.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 61-73-4
- Molecular formula: C₁₆H₁₈ClN₃S
- Molecular weight: 319.9 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__methylene-blue

### NAC
- Form: Powder vial
- Sizes & USD retail: 600mg $34.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 616-91-1
- Molecular formula: C₅H₉NO₃S
- Molecular weight: 163.2 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__nac

### Taurine
- Form: Powder vial
- Sizes & USD retail: 10g $47.99
- HPLC purity: no published lot report yet; lab report available on request
- CAS number: 107-35-7
- Molecular formula: C₂H₇NO₃S
- Molecular weight: 125.2 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__taurine

### Klotho
- Form: Lyophilized powder vial
- Sizes & USD retail: 10mg $131.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__klotho

### PEG-MGF
- Form: Lyophilized powder vial
- Sizes & USD retail: 2mg $93.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__peg-mgf

### IGF-1 DES
- Form: Lyophilized powder vial
- Sizes & USD retail: 1mg $115.99
- HPLC purity: no published lot report yet; lab report available on request
- Molecular weight: 7,371.0 g/mol
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__igf-1-des

### AC/AC Blend
- Form: Sterile laboratory solution vial (dilute acetic acid in water)
- Sizes & USD retail: 3mL $20.99
- HPLC purity: no published lot report yet; lab report available on request
- Product page (current price per size, lot details): https://vitalitychems.com/product/vial-compounds__ac-ac-blend

Wholesale and bulk pricing for qualified laboratories: https://vitalitychems.com/wholesale

## Testing and certificates of analysis (COA)

- The published third-party reports are Vanguard Laboratory HPLC-UV/VIS purity and quantity results for named lots; the figure for each lot is listed below and printed on its report. They do not include LC-MS identity, sterility or endotoxin results.
- How the lab confirmed each report (lab-hosted record or the lab's written confirmation): https://vitalitychems.com/coa-data#lab-verified-lots
- Published third-party reports show lot-specific HPLC results for the tested sample. A report applies only to the lot it names. Products without a published report: lab report available on request.
- To check a vial, enter the lot number printed on it at https://vitalitychems.com/verify. Each published lot also has its own page, listed below.
- If the exact lot certificate is not published, request it on the testing page: https://vitalitychems.com/testing.
- Every published lot report is available as an open dataset (table, CSV, JSON, CC BY 4.0): https://vitalitychems.com/coa-data, https://vitalitychems.com/coa-data.csv, https://vitalitychems.com/coa-data.json.
- How to read a COA: https://vitalitychems.com/resources/peptide-coa-checklist and https://vitalitychems.com/resources/hplc-purity-area-percent.

### Published lot reports

- Lot RT3042126: retatrutide 30mg, tested by Vanguard Laboratory, reported 2026-05-11, HPLC-UV/VIS, purity >99.80% ± 0.18%, measured quantity 29.84 mg, lab accession V260428-15 004. https://vitalitychems.com/verify/rt3042126 Report authenticity confirmed by Vanguard Laboratory by email (2026-11-01); not in the lab public lookup; copy on request from hello@vitalitychems.com.
- Lot BC10051926: bpc-157 10mg, tested by Vanguard Laboratory, reported 2026-06-01, HPLC-UV/VIS, purity >99.80% ± 0.18%, measured quantity 11.21 mg, lab accession V260521-25 009. https://vitalitychems.com/verify/bc10051926 Verify at the lab: https://www.verifiedbyvanguard.com/verify/056543ba-e36f-48a8-96e7-3e51650af71a
- Lot GHK42126: ghk-cu 100mg, tested by Vanguard Laboratory, reported 2026-05-08, HPLC-UV/VIS, purity >99.80% ± 0.18%, measured quantity 98.27 mg, lab accession V260428-13 008. https://vitalitychems.com/verify/ghk42126 Verify at the lab: https://www.verifiedbyvanguard.com/verify/25c25722-559a-46bb-ba88-f822eac6cc11

### Questions about the lab-verified lots

Q: Who tested the Vitality Chems lots, and were the reports issued to Vitality Chems?
A: Vitality Chems sells white-label vials and publishes 5 wholesaler batch reports, all tested by Vanguard Laboratory and issued to our supply chain's wholesaler (Biocode USA LLC), not to Vitality Chems. Vitality Chems has not yet commissioned its own independent test. Reports: retatrutide 20mg, sample "Lime Green Cap" (cap color, not a lot number) (reported 2026-02-26); retatrutide 30mg, lot RT3042126 (reported 2026-05-11); bpc-157 10mg, lot BC10051926 (reported 2026-06-01); bpc-tb-blend 10mg/10mg, sample "Orange Cap" (cap color, not a lot number) (reported 2026-02-26); ghk-cu 100mg, lot GHK42126 (reported 2026-05-08). Each report covers only the sample tested; for a lot without a published report, ask for its documentation. Full list: https://vitalitychems.com/coa-data#lab-verified-lots

Q: Which Vitality Chems reports can be checked on the lab's own website?
A: 4 of 5: retatrutide 20mg sample "Lime Green Cap" (cap color, not a lot number); bpc-157 10mg lot BC10051926; bpc-tb-blend 10mg/10mg sample "Orange Cap" (cap color, not a lot number); ghk-cu 100mg lot GHK42126 have a record on Verified by Vanguard (the lab's public lookup). retatrutide 30mg lot RT3042126 is not in the public lookup; Vanguard Laboratory confirmed it by email, copy on request.

Q: What did Vanguard Laboratory report for retatrutide 30mg lot RT3042126 sold by Vitality Chems?
A: Lot RT3042126 (retatrutide 30mg): >99.80% ± 0.18% purity and 29.84 mg measured quantity by HPLC-UV/VIS, reported 2026-05-11 by Vanguard Laboratory on a report issued to Biocode USA LLC (our supply chain's wholesaler), lab report V260428-15 004. Lab status: authenticity confirmed by the lab by email (2026-11-01), copy on request. Report: https://vitalitychems.com/verify/rt3042126

Q: What did Vanguard Laboratory report for bpc-157 10mg lot BC10051926 sold by Vitality Chems?
A: Lot BC10051926 (bpc-157 10mg): >99.80% ± 0.18% purity and 11.21 mg measured quantity by HPLC-UV/VIS, reported 2026-06-01 by Vanguard Laboratory on a report issued to Biocode USA LLC (our supply chain's wholesaler), lab report V260521-25 009. Lab status: verified at the lab. Report: https://vitalitychems.com/verify/bc10051926

Q: What did Vanguard Laboratory report for ghk-cu 100mg lot GHK42126 sold by Vitality Chems?
A: Lot GHK42126 (ghk-cu 100mg): >99.80% ± 0.18% purity and 98.27 mg measured quantity by HPLC-UV/VIS, reported 2026-05-08 by Vanguard Laboratory on a report issued to Biocode USA LLC (our supply chain's wholesaler), lab report V260428-13 008. Lab status: verified at the lab. Report: https://vitalitychems.com/verify/ghk42126

Q: How do I verify a Vitality Chems certificate of analysis?
A: Match the lot on the vial label to the report, open the lab's own record (Verify at the lab link, or verifiedbyvanguard.com typed in yourself) or request a copy of the lab's written confirmation from hello@vitalitychems.com, then compare compound, lot, date, purity and quantity. Steps and status for each report: https://vitalitychems.com/coa-data#lab-verified-lots

Q: Do Vitality Chems reports include identity, sterility or endotoxin testing?
A: The 5 published reports list HPLC-UV/VIS purity and quantity results. They do not list an LC-MS identity, sterility or endotoxin result, so they say nothing about those. Research use only.


## Third-party listings (verified)

These public profiles are also published as Organization JSON-LD sameAs (checked HTTP 200 on 2026-11-06):
- https://www.brownbook.net/business/56058614/vitality-chems
- https://vitalitychems.substack.com
- https://medium.com/@vitalitychems
- https://peptigrity.com/shops/vitalitychems-com
- https://www.peptidegrading.com/vendors/vitality-chems
- https://x.com/Vitalitychems
- https://x.com/VitalityXai
- https://pepassess.com/vendors/vitalitychems-com
- https://profpeptide.com/vendors/affiliate-programs/vitality-chems
- https://peptidealliance.io/chicago/vitality-chems-chicago
- https://peptidebasis.com/vendors/vitalitychems
- https://vendorverify.net/vendors/181

Open COA dataset (CC BY 4.0): https://vitalitychems.com/coa-data, https://vitalitychems.com/coa-data.csv, https://vitalitychems.com/coa-data.json.

## Shipping

- Self-serve checkout ships from US fulfillment to the United States only (Canada and Mexico paused). Verified labs elsewhere: /international-lab-orders. No OFAC-sanctioned destinations.
- Multilingual legal-market hubs: /intl/{en-ca,en-gb,en-sg,fr-ca,fr,es-mx,es,de,de-ch,de-at,pt-br,pt,it,nl,sv,da,no,fi,pl,cs,el,ro,hu,tr,ja,ko,zh-tw,ar-ae,he,th,vi,id,ms} and /intl/{lang}/product/{slug}. CAS index: /chemical-index. Atom feed: /feed.xml. Australia/New Zealand consumer parcels and OFAC destinations are never offered.
- Orders usually ship within 5 business days after payment is confirmed. Typical US transit is then 2 to 5 business days (carrier estimates, not guarantees). If an order cannot ship in that time, the buyer is told and may cancel for a prompt refund.
- Insured US Fulfillment & Lab Handling: $14.95 per order, free standard shipping on orders of $99+ in products (customer pays applicable sales tax). 100% of paid shipping returns as Next-Order Lab Rewards store credit. The rate shown at checkout before payment is the rate charged.
- Plain outer packaging with a tracking number emailed when the parcel is handed to the carrier. Each vial carries its research-use-only label.
- Free lost package policy, no add-on to buy: if tracking shows no movement for 7 business days or the carrier confirms a loss, contact support within 30 days of the expected delivery date; confirmed lost items are reshipped or refunded.
- Illinois deliveries pay Illinois sales tax at the rate for the delivery address; no Illinois sales tax on orders delivered outside Illinois.
- Shipping policy: https://vitalitychems.com/legal/shipping.

## Payment

The payment methods available for an order are shown at checkout. Card payments are processed by Stripe. Some orders can also be paid by Zelle or Bitcoin when those options appear at checkout. Illinois sales tax is added to merchandise shipped to Illinois addresses.

## Returns

Opened research materials cannot be restocked and are not returnable. A shipment that arrives damaged, incomplete, or as the wrong catalog item must be reported within 7 days of delivery with photos of the carton and vial; the lot is then replaced or the affected line refunded. Full policy: https://vitalitychems.com/legal/returns.

## Other policies

- Terms of service: https://vitalitychems.com/legal/terms
- Privacy policy: https://vitalitychems.com/legal/privacy
- Returns: https://vitalitychems.com/legal/returns
- Shipping: https://vitalitychems.com/legal/shipping
- Research use: https://vitalitychems.com/legal/research-use

## Frequently asked questions

### About Vitality Chems

Q: Is Vitality Chems legit?
A: Vitality Chems is a small US online store for research peptides that opened in October 2026, so it is new and has few or no customer reviews yet. You can check it directly: the business address, phone number ((779) 717-4445) and email (hello@vitalitychems.com) are published on the About and Contact pages, card payments are processed by Stripe, the returns, shipping, terms and research-use policies are public, and each published lab report names the testing laboratory and the lot it covers. Most reports open on the laboratory's own verification site, and you can look up the lot printed on a vial at vitalitychems.com/verify. (https://vitalitychems.com/about)

Q: Where can I read Vitality Chems reviews?
A: On the Reviews page at vitalitychems.com/reviews. Only buyers with a paid order can write one, through a one-time link emailed after delivery. Reviews are published whatever the star rating, and Vitality Chems does not pay or give discounts for reviews. (https://vitalitychems.com/reviews)

Q: Does Vitality Chems publish batch documentation?
A: Yes, where a lab report has been published for a lot. Each report names the lot, the laboratory and the test date, and applies only to that lot, because purity is lot-specific. Enter the lot number printed on your vial on the Verify page to see whether a report is published for it. (https://vitalitychems.com/verify)

Q: Why do some website checkers give vitalitychems.com a low trust score?
A: Automated website checkers score signals such as domain age, traffic and whether the owner's details are shown in the public domain record. vitalitychems.com was registered in September 2026, gets little traffic so far and uses the registrar's standard privacy service, so those tools rate it low; at the time we checked (November 2026), Scam Detector also reported the domain was not on any blacklist. These scores are not based on orders or complaints. To check us yourself, call (779) 717-4445 or email hello@vitalitychems.com, read the published policies, and pay by card through Stripe, which keeps your card issuer's dispute rights. (https://vitalitychems.com/about)

Q: Why is the client name blank on some Vitality Chems lab report images?
A: The published reports are batch reports from our supply chain's wholesaler, and the image copies we received have the client field blank. The testing laboratory's own record names the client (Biocode USA LLC, our supply chain's wholesaler), not Vitality Chems, and each report lists its lab report number so you can confirm it with the laboratory. Read these reports as batch documentation for the listed lot, not as a test of the specific vial you receive. (https://vitalitychems.com/testing)

Q: Is Vitality Chems connected to other companies named Vitality?
A: No. Vitality Chems operates only at vitalitychems.com and is not affiliated with other businesses whose names include "Vitality". Orders, lab reports and support for Vitality Chems come only from vitalitychems.com and hello@vitalitychems.com. (https://vitalitychems.com/about)

Q: Where do Vitality Chems orders ship from?
A: Orders ship in plain, tracked packaging from US fulfillment. Dispatch times and destinations are in the shipping policy. (https://vitalitychems.com/legal/shipping)

Q: What does Vitality Chems sell?
A: Research peptides and related compounds for laboratory, in-vitro and analytical research only. They are not for human or animal use, and Vitality Chems does not give dosing or usage instructions. (https://vitalitychems.com/legal/research-use)

### Ordering & research use

Q: What are these products for?
A: Every compound is sold strictly for laboratory, in-vitro, and analytical research. They are not drugs, not dietary supplements, and not for use in or on humans or animals. (https://vitalitychems.com/legal/research-use)

Q: Who can purchase?
A: Purchasers must be 21 or older, qualified for the stated laboratory work, and buying solely for lawful research. Checkout requires an active attestation. Purchasers must determine the rules that apply to their order; RUO labeling does not establish regulatory legality. We may review, hold, refuse, or cancel an order. (https://vitalitychems.com/legal/research-use)

Q: Do you give dosing or usage instructions?
A: No. Materials are sold for laboratory, in-vitro and analytical research only, so the store does not publish human or animal dosing, administration or usage instructions. (https://vitalitychems.com/legal/research-use)

Q: Do you offer wholesale or bulk pricing?
A: Yes, for qualified laboratories and bulk purchasers. See the wholesale page for how to apply. (https://vitalitychems.com/wholesale)

### Purity testing & COAs

Q: What is the purity specification?
A: Every published third-party report shows HPLC purity of 99% or higher. The published reports are Vanguard Laboratory HPLC-UV/VIS purity and quantity results and do not include LC-MS identity. Each lot figure is on its report; for products without a published report, a lab report is available on request. (https://vitalitychems.com/testing)

Q: Do you publish a certificate of analysis?
A: Yes. Published third-party reports are on the Testing page, each with the testing laboratory, method, lot and report date, plus a "Verify at the lab" link where the lab publishes the report (a report the lab confirmed by email instead is marked that way, copy on request; any other is marked lab confirmation pending). For a lot that is not listed, request its report on the Testing page. (https://vitalitychems.com/testing)

Q: How do I check the report for the vial I received?
A: Enter the lot number printed on your vial on the Verify page to look up any certificate of analysis published for that lot. A report applies only to the lot it names. (https://vitalitychems.com/verify)

Q: How should I read an HPLC purity figure?
A: HPLC purity is reported as area percent for the tested sample. The resources section explains how to read area-percent reporting and what to check on a COA. (https://vitalitychems.com/resources/hplc-purity-area-percent)

### Shipping

Q: How fast do orders ship?
A: Orders usually ship from US fulfillment within 5 business days after payment is confirmed. Typical domestic transit is 2–5 business days after that; transit times are carrier estimates rather than guarantees and may vary with review, carrier, weather, destination, or other restrictions. Outer packaging is plain and unlabeled. (https://vitalitychems.com/legal/shipping)

Q: How much is shipping?
A: Standard tracked shipping is $14.95 per order, and free on merchandise subtotals of $99.00 or more. The rate shown at checkout before you pay is the rate charged. (https://vitalitychems.com/legal/shipping)

Q: Where do you ship?
A: Self-serve checkout ships from US fulfillment to the United States only (Canada and Mexico shipping is paused). Verified laboratories elsewhere may request an export review at /international-lab-orders. We never ship to OFAC-sanctioned destinations. The purchaser is responsible for confirming that receiving the material is lawful at the destination. (https://vitalitychems.com/legal/shipping)

Q: What if my parcel is lost or stuck in transit?
A: If tracking shows no movement for 7 business days, or the carrier confirms a loss, contact us within 30 days of the expected delivery date with your order reference. Our free lost package policy reships or refunds confirmed lost items; there is no add-on to buy. (https://vitalitychems.com/legal/shipping)

### Payment, returns & support

Q: How can I pay?
A: The payment methods available for your order are shown at checkout. Card payments are processed by Stripe.

Q: Can I return a product?
A: Unopened, unused vials reported as damaged or incorrect within 7 days of delivery are replaced or refunded. Opened research materials cannot be restocked. See the returns policy for the full terms. (https://vitalitychems.com/legal/returns)

Q: How do I contact you?
A: 2045 W Grand Ave, Unit B, Chicago, IL 60612. Phone (779) 717-4445. Email hello@vitalitychems.com. (https://vitalitychems.com/contact)

## Key pages

- Shop: Browse HPLC-documented research materials: https://vitalitychems.com/
- Research library: Compound reference pages, family hubs, and analytical-method explainers: https://vitalitychems.com/research
- Laboratory research resources: Citation-ready COA, HPLC, LC-MS, and research-use references: https://vitalitychems.com/resources
- Buyer guide: what HPLC-documented research material means, what a lot-matched HPLC report must show, and how to verify a Vitality Chems lot. Also includes (merged 2026-11-04): Analytical method note: HPLC purity vs net peptide content, water and counter-ions in lyophilized peptides: https://vitalitychems.com/resources/hplc-documented-research
- Analytical method note: HPLC area percent purity, the formula, a worked example, and why it is not net peptide content or identity: https://vitalitychems.com/resources/hplc-purity-area-percent
- Buyer guide: how to read a peptide COA, 10-point checklist with field-by-field table and worked examples for verifying a research peptide certificate of analysis (lot, lab, HPLC, LC-MS, quantity): https://vitalitychems.com/resources/peptide-coa-checklist
- Compound reference: GLP-1 research peptides compared, semaglutide vs tirzepatide vs retatrutide (plus the amylin analogue cagrilintide) receptor targets, formulas, average masses, expected [M+4H]4+ m/z, and regulatory status: https://vitalitychems.com/resources/glp-1-research-compounds-compared
- Compound reference: BPC-157 CAS 137525-51-0, C62H98N16O22, 1419.5 g/mol, sequence GEPPPGKPADDAGLV, expected ions m/z 1419.7 / 710.4, solubility by charge, Asp-Asp storage note, stock-solution arithmetic, PubChem-sourced: https://vitalitychems.com/resources/bpc-157-research-reference
- Compound reference: GHK-Cu (prezatide copper) CAS 89030-95-5, PubChem C14H23CuN6O4+ 402.92 g/mol vs free GHK 340.4, solubility, copper retention (pH, EDTA, reducing agents), stock-solution arithmetic: https://vitalitychems.com/resources/ghk-cu-research-reference
- Compound reference: KPV Lys-Pro-Val, CAS 67727-97-3, C16H30N4O4, 342.43 g/mol, [M+H]+ 343.2, diketopiperazine cyclo(Lys-Pro) risk, solubility, stock-solution arithmetic: https://vitalitychems.com/resources/kpv-research-reference
- Compound reference: Epitalon / epithalon AEDG, CAS 307297-39-8, C14H22N4O9, 390.35 g/mol, Asp-Gly isomerization, solubility, storage, stock-solution arithmetic: https://vitalitychems.com/resources/epitalon-research-reference
- Compound reference: MOTS-c MRWQEMGYIFYPRKLR, CAS 1627580-64-6, C101H152N28O22S2, 2174.6 g/mol, ions m/z 725.9 / 544.7, oxidation (+16 Da), solubility, stock-solution arithmetic: https://vitalitychems.com/resources/mots-c-research-reference
- Compound reference: Tesamorelin CAS 218949-48-5, C221H366N72O67S, 5136 g/mol, N-(trans-3-hexenoyl)-hGHRH(1-44) backbone YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, HPLC/MS identity checks; research use only: https://vitalitychems.com/resources/tesamorelin-research-reference
- Compound reference: Retatrutide CAS 2381089-83-2, C221H342N46O68, 4731.36 g/mol (FDA GSRS), sequence with Aib sites, LY3437943, LC-MS identity checks; research use only: https://vitalitychems.com/resources/retatrutide-cas-mw-sequence-reference
- Compound reference: SS-31 / elamipretide (MTP-131) CAS 736992-21-5, C32H49N9O5, 639.8 g/mol (PubChem CID 11764719), sequence D-Arg-Dmt-Lys-Phe-NH2, LC-MS ions m/z 640.39 / 320.70, L-Arg diastereomer and C-terminal acid checks; research use only; also in es-MX, fr-CA, de, ja: https://vitalitychems.com/resources/ss-31-elamipretide-cas-mw-sequence-reference
- Compound reference: thymosin alpha-1 / thymalfasin CAS 62304-98-7, C129H215N33O55, 3108.3 g/mol (PubChem CID 16130571), Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH (UniProt P06454 residues 2-29), HPLC at 214-220 nm (no aromatic residues), LC-MS charge states, des-acetyl impurity; research use only; also in es-MX, fr-CA, de, ja: https://vitalitychems.com/resources/thymosin-alpha-1-cas-mw-sequence-reference
- SS-31 (elamipretide) CAS/MW/sequence reference (es-MX); research use only: https://vitalitychems.com/intl/es-mx/resources/ss-31-elamipretide-cas-mw-sequence-reference
- SS-31 (elamipretide) CAS/MW/sequence reference (fr-CA); research use only: https://vitalitychems.com/intl/fr-ca/resources/ss-31-elamipretide-cas-mw-sequence-reference
- SS-31 (elamipretide) CAS/MW/sequence reference (de); research use only: https://vitalitychems.com/intl/de/resources/ss-31-elamipretide-cas-mw-sequence-reference
- SS-31 (elamipretide) CAS/MW/sequence reference (ja); research use only: https://vitalitychems.com/intl/ja/resources/ss-31-elamipretide-cas-mw-sequence-reference
- Thymosin alpha-1 (thymalfasin) CAS/MW/sequence reference (es-MX); research use only: https://vitalitychems.com/intl/es-mx/resources/thymosin-alpha-1-cas-mw-sequence-reference
- Thymosin alpha-1 (thymalfasin) CAS/MW/sequence reference (fr-CA); research use only: https://vitalitychems.com/intl/fr-ca/resources/thymosin-alpha-1-cas-mw-sequence-reference
- Thymosin alpha-1 (thymalfasin) CAS/MW/sequence reference (de); research use only: https://vitalitychems.com/intl/de/resources/thymosin-alpha-1-cas-mw-sequence-reference
- Thymosin alpha-1 (thymalfasin) CAS/MW/sequence reference (ja); research use only: https://vitalitychems.com/intl/ja/resources/thymosin-alpha-1-cas-mw-sequence-reference
- Compound reference: cagrilintide research peptide, CAS 1415456-99-3, C194H312N54O59S2, 4409.0 g/mol, sequence vs human amylin, expected LC-MS ions m/z 1470.7/1103.3/882.8, and COA checks, PubChem-sourced: https://vitalitychems.com/resources/cagrilintide-research-peptide
- Method explainer: HPLC purity vs LC-MS identity for research peptides, what each proves and its blind spots. Also includes (merged 2026-11-04): Analytical method note: what an LC-MS identity result proves for a peptide, Na/K/NH4 adduct offsets, oxidation (+15.995) and deamidation (+0.984) shifts, and isomer blind spots: https://vitalitychems.com/resources/hplc-vs-lc-ms
- Method explainer: bacterial endotoxin testing (USP <85>, LAL gel-clot/turbidimetric/chromogenic, recombinant factor C) and EU/mg results: https://vitalitychems.com/resources/endotoxin-testing-lal
- Method explainer: USP <71> sterility testing vs validated rapid microbiological methods (USP <1223>): https://vitalitychems.com/resources/usp-71-sterility-vs-rapid-methods
- Buyer guide: how to check a testing lab's ISO/IEC 17025 accreditation and scope: https://vitalitychems.com/resources/iso-17025-accreditation-scope
- Lab handling reference: storing lyophilized research peptides (USP <659> temperatures, light, moisture, freeze-thaw, oxidation-prone residues, storage records): https://vitalitychems.com/resources/lyophilized-peptide-storage-handling
- Compound reference table: molecular formula, molecular weight, CAS number and PubChem CID for 25 research peptides, PubChem-sourced and CAS cross-checked: https://vitalitychems.com/resources/peptide-molecular-weight-cas-reference
- Lab calculator: expected [M+zH]z+ m/z values for peptide LC-MS identity checks, average vs monoisotopic mass, reading a COA mass spectrum: https://vitalitychems.com/resources/peptide-lc-ms-expected-mz-calculator
- Compound reference: BPC-157 vs TB-500 sequence, formula, molecular weight, CAS, PubChem CID and expected LC-MS m/z, PubChem-sourced: https://vitalitychems.com/resources/bpc-157-vs-tb-500-compared
- Compound identity: TB-500 is the 889 Da acetylated fragment Ac-LKKTETQ (CAS 885340-08-9), not 4963 Da thymosin beta-4 (CAS 77591-33-4); how to tell from a COA mass spectrum: https://vitalitychems.com/resources/tb-500-vs-thymosin-beta-4
- Buyer guide: reading a BPC-157 / TB-500 blend certificate of analysis (two peaks, per-component quantity and identity, lab lookups): https://vitalitychems.com/resources/bpc-157-tb-500-blend-coa
- Compound reference: sermorelin and tesamorelin (GHRH receptor) vs ipamorelin, GHRP-2 and hexarelin (ghrelin receptor GHS-R1a), structures and PubChem formulas: https://vitalitychems.com/resources/ghrh-analogs-vs-ghrelin-receptor-agonists
- Analytical method note: TFA vs acetate peptide salt forms, counter-ion mass, and cell-assay considerations: https://vitalitychems.com/resources/tfa-vs-acetate-peptide-salts
- Compound reference: CJC-1295 with DAC vs without DAC (mod GRF 1-29), structure, albumin binding, and COA identity checks: https://vitalitychems.com/resources/cjc-1295-dac-vs-no-dac
- Compound reference: Selank (TKPRPGP, tuftsin + Pro-Gly-Pro, C33H57N11O9, 751.9 g/mol) vs Semax (MEHFPGP, ACTH(4-7) + Pro-Gly-Pro, C37H51N9O10S, 813.9 g/mol), PubChem-sourced, with expected LC-MS ions: https://vitalitychems.com/resources/selank-vs-semax
- Buyer guide: how to spot a fake, altered or borrowed peptide COA, nine checks (lab lookup, lot match, client field, chromatogram reuse, mass mismatch, quantity, dates, ISO/IEC 17025 scope, PDF edits) with PubMed-cited surveys of falsified peptide products: https://vitalitychems.com/resources/how-to-spot-fake-peptide-coa
- Buyer guide: how to verify a peptide COA in seven steps (lot match, issuing lab, lab-hosted lookup or email, compare values), with a worked example on a lab-verified BPC-157 report and each lab's lookup method. Also includes (merged 2026-11-04): Lab lookup guide: confirming a Vanguard Laboratory peptide COA on Verified by Vanguard; A2LA scope; cap-color sample IDs: https://vitalitychems.com/resources/how-to-verify-peptide-coa
- Reference table: peptide COA and testing standards compared by criteria (HPLC purity, MS identity, quantity, lot ID, lab confirmation, ISO/IEC 17025 scope, USP <85> endotoxin, USP <71> sterility), with counts computed from our published reports; no companies rated: https://vitalitychems.com/resources/peptide-coa-testing-standards
- Buyer guide: peptide lot numbers explained (21 CFR 210.3 definition, where the lot is on the vial, cap color is not a lot, how to look up a COA by lot number on /verify, what not found means, lot traceability records), with a table of every lot that has a published report: https://vitalitychems.com/resources/peptide-lot-numbers-explained
- Analytical guide: what a COA for a lyophilized semaglutide research vial should show (lot match, LC-MS identity vs PubChem CID 56843331 formula and mass, HPLC purity with method, measured mg, issuing lab); states whether a semaglutide lot report is published; no use or preparation guidance: https://vitalitychems.com/resources/semaglutide-research-vial-coa
- Free tool: browser-only peptide COA checker (lot match, named lab and lookup, report date, purity method, chromatogram, observed mass or m/z vs PubChem molecular weight, measured quantity): https://vitalitychems.com/resources/peptide-coa-checker
- Business guide: how to start private label research peptides (eligibility, 10-vial minimum, label fees with a worked example, excluded compounds, payment and endorsement rules): https://vitalitychems.com/resources/private-label-peptides-how-to-start
- Stability chemistry: peptide degradation pathways (Met oxidation +15.995 Da, Asn deamidation +0.984 Da, isobaric Asp isomerization, hydrolysis, pyroglutamate -17.027/-18.011 Da, diketopiperazines, aggregation) with primary literature: https://vitalitychems.com/resources/peptide-degradation-pathways
- Lab method note: predicting peptide solubility from sequence charge at pH 7, hydrophobic share and pI, with solvent cautions (DMSO and Cys/Met) for in-vitro and analytical work: https://vitalitychems.com/resources/peptide-solubility-sequence-charge
- Free lab calculator: peptide net charge vs pH and isoelectric point (pI) from a one-letter sequence, EMBOSS pKa set, Ac-/-NH2 termini and disulfides, with copy-paste embed code: https://vitalitychems.com/resources/peptide-net-charge-isoelectric-point-calculator
- Free embeddable COA checklist card, per-lot COA published badges, and Verified Partner badge (plain HTML) with embedding instructions: https://vitalitychems.com/resources/coa-checklist-embed
- Glossary: analytical, QC and lab-handling terms on peptide lot reports (HPLC, LC-MS, area percent, net peptide content, endotoxin, TFA salt, lot) with primary sources: https://vitalitychems.com/glossary
- Open COA lot dataset and lab verification status: every published lot report (lot, lab, accession number, date, methods, purity, quantity) with a Verify at the lab link or the lab's written confirmation (including Retatrutide 30mg lot RT3042126, confirmed by Vanguard Laboratory by email, copy on request), as a table, CSV (/coa-data.csv) and JSON (/coa-data.json), CC BY 4.0. Also includes (merged 2026-11-05): which lot reports the lab has confirmed: https://vitalitychems.com/coa-data
- Verify a lot: look up a published certificate of analysis by the lot number printed on a vial: https://vitalitychems.com/verify
- Buy research peptides online: HPLC-documented analytical reference peptides for in-vitro laboratory use only (RUO), lot COA lookup, insured US fulfillment: https://vitalitychems.com/buy-research-peptides
- CAS and molecular weight analytical index for research peptides (verified catalog constants only): https://vitalitychems.com/chemical-index
- Atom catalog feed of research peptides and multilingual hubs: https://vitalitychems.com/feed.xml
- International institutional / laboratory export inquiry for verified labs outside the US (self-serve checkout is US-only; Canada and Mexico paused): https://vitalitychems.com/international-lab-orders
- Affiliate program: new partners (codes from 2026-11-09) get a 10% buyer code and a flat 15% cash or 18% store credit on first and repeat orders; earlier codes keep their stored rates: https://vitalitychems.com/affiliates
- Independent referrer terms: not employment, no W-9 to start, RUO firewall, indemnification, code kill-switch: https://vitalitychems.com/legal/affiliate-terms
- Compound reference: KLOW, GLOW and Wolverine multi-peptide research blends (BPC-157, TB-500, GHK-Cu, KPV), PubChem identities and per-component COA requirements: https://vitalitychems.com/resources/klow-glow-wolverine-peptide-blends
- Regulatory and analytical guide: FDA statements on retatrutide sold online and LC-MS identity testing (expected m/z 1577.16, 1183.13, 946.70): https://vitalitychems.com/resources/counterfeit-retatrutide-identity-testing
- Buyer guide: where to buy research BPC-157 with a lot-matched certificate of analysis you can confirm at the issuing lab, including Vitality Chems lot BC10051926 (Vanguard Laboratory, HPLC-UV/VIS, lab-hosted verification); research use only: https://vitalitychems.com/resources/where-to-buy-bpc-157-with-coa
- Buyer guide: how to read a peptide certificate of analysis (lot, laboratory, purity method, identity data, measured quantity), with a worked BPC-157 lot example; missing tests are unreported; research use only: https://vitalitychems.com/resources/how-to-read-a-peptide-coa
- Buyer guide: how to verify a research peptide vendor before ordering (seller identity, lot-matched COA confirmed at the lab, missing-test disclosure, research-use language); research use only: https://vitalitychems.com/resources/how-to-verify-a-peptide-vendor
- Lab handling: how to store unopened lyophilized research peptides after arrival (closed vial, dry, dark, stated temperature, lot traceability); no preparation instructions; research use only: https://vitalitychems.com/resources/research-peptide-storage
- Buyer guide: what a tested research peptide claim should mean (named lot, named lab, confirmable results); Vitality Chems publishes five Vanguard HPLC-UV/VIS lot reports, not a report for every catalog item; research use only: https://vitalitychems.com/resources/are-research-peptides-tested
- Buyer guide: where to buy research peptides with a lab-confirmable COA, and which Vitality Chems lots currently have a published report (BPC-157 10 mg, GHK-Cu 100 mg, retatrutide 20 mg and 30 mg, BPC/TB blend); research use only: https://vitalitychems.com/resources/where-to-buy-research-peptides-with-coa
- Buyer guide: how to compare research peptide vendors on dated public prices, confirmable lot reports, assays and shipping; no fake compare-at prices; research use only: https://vitalitychems.com/resources/how-to-compare-research-peptide-vendors
- Sourced comparison hub: Vitality Chems vs Peptagon, Bench Grade Peptides, Core Peptides and Oath Research on published prices, testing documentation and shipping, each figure cited and dated; not a review; research use only: https://vitalitychems.com/resources/research-peptide-vendor-comparison
- Sourced comparison: Vitality Chems vs Peptagon published BPC-157 and TB-500 prices, testing claims and shipping, checked 2026-11-11, sources cited; not a review; research use only: https://vitalitychems.com/resources/vitality-vs-peptagon
- Sourced comparison: Vitality Chems vs Bench Grade Peptides published prices, certificate library and shipping, checked 2026-11-11, sources cited; not a review; research use only: https://vitalitychems.com/resources/vitality-vs-bench-grade
- Sourced comparison: Vitality Chems vs Core Peptides published prices, COA library and shipping, checked 2026-11-11, sources cited; not a review; research use only: https://vitalitychems.com/resources/vitality-vs-core-peptides
- Sourced comparison: Vitality Chems vs Oath Research published prices, testing claims and shipping, checked 2026-11-11, sources cited; not a review; research use only: https://vitalitychems.com/resources/vitality-vs-oath-research
- Community partners: unique trackable codes for Discord, Telegram, forum and subreddit operators; 10% friend discount and new-partner commission within a 25% net margin floor; independent referrers, no income claims; research use only: https://vitalitychems.com/community-partners
- Sourcing guide: how a lab vets a research peptide vendor (seller identity, lot-matched COA confirmed by the issuing lab, ISO/IEC 17025 scope via ILAC, FDA warning letter search, research-use-only product language, FTC review rule 16 CFR 465). Also includes (merged 2026-11-04): Sourcing guide: what a third-party tested claim on a research peptide should mean (independent, lot-specific, confirmable), identity/purity/quantity results, ISO/IEC 17025 scope, five-step check: https://vitalitychems.com/resources/how-to-vet-peptide-vendors
- Peptide chemistry guide: Fmoc SPPS impurities (deletion, insertion, truncation, racemization, protecting-group adducts, aspartimide -18 Da, oxidation +16 Da, dimers) and non-peptide content (TFA, water, ICH Q3C solvents), and which COA result detects each: https://vitalitychems.com/resources/synthetic-peptide-impurities
- Storage science guide: retest date vs expiry date on a peptide COA (ICH Q7 definitions), how stability studies set them (ICH Q1A(R2) long-term, 40 C/75% RH accelerated, -20 C freezer; Q1E extrapolation), solid-state degradation, five checks: https://vitalitychems.com/resources/peptide-coa-retest-date
- Lab methods guide: heavy metals / elemental impurities testing of peptides (ICP-MS, ICP-OES, AAS, XRF), ICH Q3D element classes (As, Cd, Hg, Pb Class 1), USP <232>/<233> replacing <231>, reading ppm and detection limits, GHK-Cu copper is not an impurity: https://vitalitychems.com/resources/peptide-heavy-metals-testing
- Technical buyer guide: How to evaluate research materials, lot records, HPLC purity, LC-MS identity, and COAs: https://vitalitychems.com/resources/research-material-selection
- Testing & COA requests: Review testing standards and request lot documentation: https://vitalitychems.com/testing
- Contact: Get in touch with Vitality Chems: https://vitalitychems.com/contact
- About: Who runs Vitality Chems, the business address, how orders are fulfilled, and which US labs test the materials: https://vitalitychems.com/about
- Reviews: Verified-buyer reviews only, and how reviews are collected and moderated: https://vitalitychems.com/reviews
- FAQ: Purchaser eligibility, HPLC purity specification, COAs and lot verification, shipping, payment and returns: https://vitalitychems.com/faq
- Restock subscriptions: Not currently open for new enrollment: https://vitalitychems.com/subscriptions
- Wholesale research peptides: Information for qualified laboratories and bulk purchasers: https://vitalitychems.com/wholesale
- Private label research peptides: US fulfillment; wholesaler batch COAs (US lab, checkable on the lab lookup) published by lot number; your own label from 10 vials; optional fulfillment under your name; research use only: https://vitalitychems.com/private-label-peptides
- Work with us: every way to work with Vitality Chems (wholesale, private label, affiliates, partner/UGC proposals, investor questions). Also includes (merged 2026-11-05): Partners: UGC, laboratory education, distribution, and investor conversations: https://vitalitychems.com/work-with-us
- Investors: company status, gross margin computed from live list prices, cited market estimates, e-commerce benchmarks, and key risks (no projections): https://vitalitychems.com/investors
- Research-use policy: Review restrictions and purchaser responsibilities: https://vitalitychems.com/legal/research-use
- Terms of service: Review site and purchase terms: https://vitalitychems.com/legal/terms
- Privacy policy: Review how personal information is handled: https://vitalitychems.com/legal/privacy
- Returns policy: Review eligibility and return requirements: https://vitalitychems.com/legal/returns
- Shipping policy: Dispatch estimates, rates, destinations, tracking and lost-parcel handling: https://vitalitychems.com/legal/shipping
- Accessibility statement: WCAG 2.2 AA target, known limits, and how to get help by email or phone: https://vitalitychems.com/legal/accessibility

## Research library

- No reference pages are published yet.